PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_8439AC445.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 335aa    MW: 35595 Da    PI: 8.6816
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_8439AC445.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-0761123163
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            eke kr rr   NRe+Ar   +R++a  +eL++kv+ L ++N+ +kke ++  +++ +lk  +
  Traes_4BS_8439AC445.2  61 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLASQNENMKKEKDMVLEQYLTLKETN 123
                            89************************************************9999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001707.5E-761123IPR004827Basic-leucine zipper domain
SMARTSM003384.3E-1061125IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.65763126IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.47E-665119No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-465129No hitNo description
CDDcd147025.03E-1566116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEHEDEELAS TRLSLELGNV GIQSSPCSSS SSGAGQQPPQ SSAAVTGYGL SRPRHMLTEA  60
EKEAKRLRRV LANRESARQT ILRRQAIRDE LARKVADLAS QNENMKKEKD MVLEQYLTLK  120
ETNKQLKQQV AKTTKKKPSS TPAITPMDIA PPAQSAEATP PQTPPQPSFL YSAPPTSMPV  180
PYVWGSWPPC GPGVYEHGGN PAGMAGHAPT PLCVPPACAW YYPVVAASTD PRGSPPAYVQ  240
PFQEPTGSGG TAGEDTDDDP CSLTLAIDAA DKKSPAAGPN AYQSSSGVVG AVGLQVALSG  300
REKAATAAEA RKRRKELTKL KQMHGGSRHG AGEHW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310315RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3596220.0AK359622.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1100C17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615785.11e-100PREDICTED: translation initiation factor IF-2
TrEMBLW5EBV30.0W5EBV3_WHEAT; Uncharacterized protein
STRINGMLOC_15316.11e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.12e-18bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]